PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g61160.1.p
Common NameBRADI_1g61160, LOC100835602
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 270aa    MW: 29378.7 Da    PI: 6.7815
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g61160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv +v+ +G+g+W++++   g+ R+ k+c++rw +yl
  Bradi1g61160.1.p 14 KGPWTPEEDIILVSYVQDHGPGNWRAVPPNTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding50.74.2e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++++E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Bradi1g61160.1.p  67 RGNFSEQEEKHIVQLQALLGNR-WAAIASYLP-DRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.375965IPR017930Myb domain
SuperFamilySSF466897.49E-3011108IPR009057Homeodomain-like
SMARTSM007173.7E-131363IPR001005SANT/Myb domain
PfamPF002492.4E-151461IPR001005SANT/Myb domain
CDDcd001673.09E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.1E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129419.53566116IPR017930Myb domain
SMARTSM007177.2E-1566114IPR001005SANT/Myb domain
PfamPF002493.5E-1567112IPR001005SANT/Myb domain
CDDcd001674.49E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRPPCCDKD GVKKGPWTPE EDIILVSYVQ DHGPGNWRAV PPNTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF SEQEEKHIVQ LQALLGNRWA AIASYLPDRT DNDIKNYWNT HLKKKLLHRT  120
STATPAPAPT THKDQNNNKG QWERRLQTDI HLARQALREA LSLDTASTSA TPGPAAYALS  180
AQNVSRMLDD WAVAADSASS EVTECSGGST ASNGTLWSSL LGRESTGAAA AGVEDPAALS  240
AIESWLLLDD GTDRQQPPEQ EQSGGQLLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-26141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-26141164105C-Myb DNA-Binding Domain
1msf_C8e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAPTransfer from AT1G74650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0988921e-128FP098892.1 Phyllostachys edulis cDNA clone: bphylf052j22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561588.10.0PREDICTED: myb-related protein 306-like
SwissprotP813924e-95MYB06_ANTMA; Myb-related protein 306
TrEMBLI1H5110.0I1H511_BRADI; Uncharacterized protein
STRINGBRADI1G61160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.22e-89myb domain protein 96